.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wj9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein TTHB192 from Thermus thermophilus HB8 reveals a new protein family with an RNA recognition motif-like domain. Protein Sci. 15 1494-1499 2006
    Site RSGI
    PDB Id 1wj9 Target Id ttk003001711.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14782, Molecular Weight 23723.39 Da.
    Residues 211 Isoelectric Point 10.32
    Sequence mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvlvqtltepdw svldegyaqvfppkpfhpalkpgqrlrfrlranpakrlaatgkrvalktpaekvawlerrleeggfrll egergpwvqilqdtflevrrkkdgeeagkllqvqavlfegrlevvdperalatlrrgvgpgkalglgll svap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.247
    Matthews' coefficent 3.10 Rfactor 0.228
    Waters 100 Solvent Content 60.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wj9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch