The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of an Arabidopsis WRKY DNA binding domain. Plant Cell 17 944-956 2005
    Site RSGI
    PDB Id 1wj2 Target Id atr001010103.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12251, Molecular Weight 8052.67 Da.
    Residues 71 Isoelectric Point 9.20
    Sequence vqttsevdllddgyrwrkygqkvvkgnpyprsyykcttpgcgvrkhveraatdpkavvttyegkhnhdl pa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 1wj2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch