The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of phosphotyrosine interaction domain of mouse Numb protein. To be Published
    Site RSGI
    PDB Id 1wj1 Target Id mmt007011213.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13534, Molecular Weight 16202.77 Da.
    Residues 143 Isoelectric Point 8.96
    Sequence asrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkkavkavlwvsadglrvv dektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmavkdtgerlshavgcafaacle rkqkr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wj1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch