.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wiy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of Cytochrome P450 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wiy Target Id ttk003001263.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14675, Molecular Weight 44226.80 Da.
    Residues 389 Isoelectric Point 9.72
    Sequence mkrlslreawpylkdlqqdplavllewgrahprlflplprfplalifdpegvegallaegttkatfqyr alsrltgrglltdwgkswkearkalkdpflpksvrgyreameeeawaffgewrgeerdldhemlalslr llgralfgkplspslaehalkaldrimaqtrsplalldlaaearfrkdrgalyreaealivhpplshlp reralseavtllvaghetvasaltwsflllshrpdwqkrvaeseeaalaafqealrlyppawiltrrle rplllgedrlpqgttlvlspyvtqrlyfpegeafqperflaergtpsgryfpfglgqrlclgrdfalle gpivlraffrrfrldplpfprvlaqvtlrpegglparpregvra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.231
    Matthews' coefficent 2.10 Rfactor 0.197
    Waters 247 Solvent Content 41.30

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 1wiy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch