The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of RSGI RUH-026, conserved domain of HOOK1 protein from mouse. To be Published
    Site RSGI
    PDB Id 1wix Target Id mmt007117507.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13606, Molecular Weight 17189.03 Da.
    Residues 151 Isoelectric Point 5.29
    Sequence lplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrikddvgdnwrikasnlkk vlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqlilgcavncekkqehiknimtleesvq hvvmtaiqelmsk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wix

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch