The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glucose-6-phosphate isomerase like protein from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wiw Target Id ttk003001570.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14744, Molecular Weight 31698.57 Da.
    Residues 290 Isoelectric Point 4.80
    Sequence mrdldreetylvdrtglalelrdlvgtgpvpgeaypgphaalgygegqfaallsglpdwgeegtlflle ggydlgeaagmallaetgrarvvrvgfrpgvevhippsplapyrylrflllatgreevlrsvdeallee rrrlgpevpveenpakflaytllerlplfysplfrplegavqtlfarvakslsltpppsalefflvgle arheqgdplaavllgpgeeaalakeilesrvdalaevpatganrlaqvmalwyrmawtayylallygvd pgdhgllerlrevt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.235
    Matthews' coefficent 2.20 Rfactor 0.195
    Waters 282 Solvent Content 42.80

    Ligand Information


    Google Scholar output for 1wiw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch