The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C2H2 zinc finger domain of the protein arginine N-methyltransferase 3 from Mus musculus. To be Published
    Site RSGI
    PDB Id 1wir Target Id mmt007007317.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13498, Molecular Weight 12779.83 Da.
    Residues 108 Isoelectric Point 4.94
    Sequence epahgrqhtpclfcdrlfasaeetfshcklehqfnidsmvhkhglefygyiklinfirlknptveymns iynpvpwekdeylkpvleddlllqfdvedlyepvstpfs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 1wir

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch