The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA. To be Published
    Site RSGI
    PDB Id 1wii Target Id mmt007016237.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13564, Molecular Weight 8232.99 Da.
    Residues 72 Isoelectric Point 5.32
    Sequence rkpppkkkmtgtletqftcpfcnhekscdvkmdrarntgvisctvcleefqtpitylsepvdvysdwid ace
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 1wii

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch