The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-021, a domain II of ribosome recycling factor from Mouse cDNA. To be Published
    Site RSGI
    PDB Id 1wih Target Id mmt007020407.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13584, Molecular Weight 7540.47 Da.
    Residues 71 Isoelectric Point 6.77
    Sequence ldhitvvtadgkvalnqigqismkspqvilvnmasfpectaaaikairesgmnlnpevegtlirvpipk vt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wih

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch