.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wig

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-019, a LIM domain of actin binding LIM protein 2 (KIAA1808 protein) from human cDNA. To be Published
    Site RSGI
    PDB Id 1wig Target Id hsk002001776.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12683, Molecular Weight 6753.25 Da.
    Residues 60 Isoelectric Point 5.50
    Sequence cdscekyitgrvleagekhyhpscalcvrcgqmfaegeemylqgssiwhpacrqaarted
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1wig

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch