.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wid

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the B3 DNA Binding Domain of the Arabidopsis Cold-Responsive Transcription Factor RAV1. Plant Cell 16 3448-3459 2004
    Site RSGI
    PDB Id 1wid Target Id atr001006482.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12245, Molecular Weight 13302.31 Da.
    Residues 117 Isoelectric Point 9.87
    Sequence rsaealfekavtpsdvgklnrlvipkhhaekhfplpssnvsvkgvllnfedvngkvwrfrysywnssqs yvltkgwsrfvkeknlragdvvsfsrsngqdqqlyigwksrsgsdlda
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wid

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch