.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wic

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the MSP domain of RIKEN cDNA 6030424E15. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wic Target Id mmt007115554.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13604, Molecular Weight 15292.87 Da.
    Residues 139 Isoelectric Point 9.17
    Sequence kkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttapekyrvkpsnsscdpga sidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwkevprnkvmehrlrchtvesskpnslml
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wic

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch