The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal domain from mouse hypothetical protein BAB22488. To be Published
    Site RSGI
    PDB Id 1wib Target Id mmk001000344.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13421, Molecular Weight 8281.19 Da.
    Residues 79 Isoelectric Point 9.53
    Sequence ppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwkglritvkltiqnrqaq ievvpsasal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wib

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch