The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PCI domain from mouse hypothetical protein AAH51541. To be Published
    Site RSGI
    PDB Id 1wi9 Target Id mmt007119227.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13609, Molecular Weight 6776.53 Da.
    Residues 59 Isoelectric Point 5.09
    Sequence fltefinyikkskvvlledlafqmglrtqdainriqdlltegtltgviddrgkfiyitp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wi9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch