.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wi8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain of eukaryotic initiation factor 4B. To be Published
    Site RSGI
    PDB Id 1wi8 Target Id hss001000201.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13188, Molecular Weight 10242.84 Da.
    Residues 91 Isoelectric Point 4.83
    Sequence srlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfgyaefedldsllsalsl neeslgnkrirvdvadqaqdkd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wi8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch