The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the homeodomain of KIAA1034 protein. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wi3 Target Id hsk002001010.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12627, Molecular Weight 6750.43 Da.
    Residues 58 Isoelectric Point 9.35
    Sequence prsrtkislealgilqsfihdvglypdqeaihtlsaqldlpkhtiikffqnqryhvkh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wi3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch