.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wi0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PB1 domain of mouse mitogen activated protein kinase kinase 5 (MAP2K5). To be Published
    Site RSGI
    PDB Id 1wi0 Target Id mmt007017439.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13569, Molecular Weight 11408.38 Da.
    Residues 100 Isoelectric Point 4.29
    Sequence pfcamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafeyededgdritvrsde emkamlsyyystvmeqqvngqlieplqifpr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wi0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch