.
The Open Protein Structure Annotation Network
PDB Keyword
.

1whw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal RNA binding domain from hypothetical protein BAB23448. To be Published
    Site RSGI
    PDB Id 1whw Target Id mmt007011210.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13533, Molecular Weight 9712.60 Da.
    Residues 86 Isoelectric Point 6.80
    Sequence sgrlfvrnlsytsseedleklfsaygplselhypidsltkkpkgfafvtfmfpehavkayaevdgqvfq grmlhvlpstikkeasq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1whw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch