.
The Open Protein Structure Annotation Network
PDB Keyword
.

1whq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848. To be Published
    Site RSGI
    PDB Id 1whq Target Id mmt007009190.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13514, Molecular Weight 9726.73 Da.
    Residues 86 Isoelectric Point 9.60
    Sequence iknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkdaqsnaardfvnylvri nevkseevpavgivppp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1whq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch