The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the dsRBD from hypothetical protein BAB26260. To be Published
    Site RSGI
    PDB Id 1whn Target Id mmt007002726.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13471, Molecular Weight 13203.61 Da.
    Residues 115 Isoelectric Point 9.51
    Sequence sgiikmairfdrrayppqitpkmcllewcrreklpqpvyetvqrtidrmfcsvvtvaeqkyqstlwdks kklaeqtaaivclrsqglpegrlgeespslnkrkreapdqdpggpr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1whn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch