The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 3rd CAP-Gly domain in mouse 1700024K14Rik hypothetical protein. To be Published
    Site RSGI
    PDB Id 1whk Target Id mmt007112333.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13601, Molecular Weight 8519.27 Da.
    Residues 78 Isoelectric Point 9.52
    Sequence legtvklhegsqvlltssnematvryvgptdfasgiwlglelrsakgkndgavgdkryftckpnygvlv rpsrvtyrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1whk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch