The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 1st CAP-Gly domain in mouse 1700024K14Rik hypothetical protein. To be Published
    Site RSGI
    PDB Id 1whj Target Id mmt007112333.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13600, Molecular Weight 9556.52 Da.
    Residues 89 Isoelectric Point 9.51
    Sequence vlpnsdhttsramltslglklgdrvviagqkvgtlrfcgttefasgqwagieldepegknngsvgrvqy fkcapkygifaplskisklk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1whj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch