.
The Open Protein Structure Annotation Network
PDB Keyword
.

1whg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CAP-Gly domain in mouse tubulin specific chaperone B. To be Published
    Site RSGI
    PDB Id 1whg Target Id mmt007003018.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13473, Molecular Weight 10998.68 Da.
    Residues 100 Isoelectric Point 6.80
    Sequence neelraqqeaeaaqrlseekaqasaisvgsrcevrapdhslrrgtvmyvgltdfkpgywvgvrydeplg kndgsvngkryfecqakygafvkpsavtvgd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1whg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch