The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain of RGS3. To be Published
    Site RSGI
    PDB Id 1whd Target Id mmt007012264.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13545, Molecular Weight 9710.54 Da.
    Residues 87 Isoelectric Point 5.07
    Sequence egdpengeklqitirrgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkcvel aheirscpseiillvwrv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1whd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch