The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140. To be Published
    Site RSGI
    PDB Id 1wh7 Target Id atr001010579.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12253, Molecular Weight 7794.52 Da.
    Residues 67 Isoelectric Point 10.12
    Sequence snpsssggttkrfrtkftaeqkekmlafaerlgwriqkhddvaveqfcaetgvrrqvlkiwmhnnkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wh7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch