The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second CUT domain of human Homeobox protein Cux-2. To be Published
    Site RSGI
    PDB Id 1wh6 Target Id hsk002100285.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12698, Molecular Weight 10071.15 Da.
    Residues 88 Isoelectric Point 9.46
    Sequence qyelymyrevdtleltrqvkeklakngicqrifgekvlglsqgsvsdmlsrpkpwskltqkgrepfirm qlwlsdqlgqavgqqpgas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wh6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch