.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wgy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title RA domain of guanine nucleotide exchange factor for Rap1. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wgy Target Id hsk002000269.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12578, Molecular Weight 10257.08 Da.
    Residues 91 Isoelectric Point 4.93
    Sequence eeifchvyitehsyvsvkakvssiaqeilkvvaekiqyaeedlalvaitfsgekhelqpndlvisksle asgriyvyrkdladtlnpfaen
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wgy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch