The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RSGI RUH-022, a myb DNA-binding domain in human cDNA. To be Published
    Site RSGI
    PDB Id 1wgx Target Id hsk002001870.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12688, Molecular Weight 6867.44 Da.
    Residues 60 Isoelectric Point 9.07
    Sequence dkewnekelqklhcafaslpkhkpgfwsevaaavgsrspeecqrkymenprgkgsqkhvt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wgx

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch