The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase. To be Published
    Site RSGI
    PDB Id 1wgs Target Id mmt007114348.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13603, Molecular Weight 14219.10 Da.
    Residues 120 Isoelectric Point 5.65
    Sequence epevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrldewvdknrlaltktvkda vqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpttaaleke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wgs

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch