The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PKD domain from human VPS10 domain-containing receptor SorCS2. To be Published
    Site RSGI
    PDB Id 1wgo Target Id hsk002001303.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12647, Molecular Weight 12101.11 Da.
    Residues 110 Isoelectric Point 4.85
    Sequence ceggvdmqqsqvqlqcpltpprglqvsiqgeavavrpgedvlfvvrqeqgdvlttkyqvdlgdgfkamy vnltltgepirhryespgiyrvsvraentaghdeavlfvqv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wgo

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch