.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wgk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Mouse Hypothetical Protein 2900073H19RIK. To be Published
    Site RSGI
    PDB Id 1wgk Target Id mmt007018075.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13571, Molecular Weight 11322.48 Da.
    Residues 101 Isoelectric Point 4.61
    Sequence maaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqgdsvrpgilv lindadwellgeldyqlqdqdsilfistlhgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wgk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch