.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wgd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Ubl-domain of Herp. To be Published
    Site RSGI
    PDB Id 1wgd Target Id hsk002000023.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12567, Molecular Weight 9392.45 Da.
    Residues 80 Isoelectric Point 9.83
    Sequence vtllvkspnqrhrdlelsgdrgwsvghlkahlsrvyperprpedqrliysgkllldhqclrdllpkqek rhvlhlvcnvk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wgd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch