The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a predicted S-adenosylmethionine-dependent methyltransferase TT1512 from Thermus thermophilus HB8 at 2.0 Ang. resolution. To be Published
    Site RSGI
    PDB Id 1wg8 Target Id ttk003001512.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14735, Molecular Weight 31169.39 Da.
    Residues 285 Isoelectric Point 9.81
    Sequence mrpmthvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavarakglhlpglt vvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsrgfsyqkegpldmrmglegptakevvnrlp lealarllrelgeepqayriaraivaarekapietttqlaeivrkavgfrraghparktfqalriyvnd elnalkefleqaaevlapggrlvviafhsledrvvkrflresglkvltkkplvpsekeaaqnprarsak lraaekeap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.263
    Matthews' coefficent 2.50 Rfactor 0.216
    Waters 232 Solvent Content 51.20

    Ligand Information


    Google Scholar output for 1wg8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch