.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wg0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural comparison of Nas6p protein structures in two different crystal forms. To be Published
    Site RSGI
    PDB Id 1wg0 Target Id ar_001000295.1
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS12139, Molecular Weight 25614.98 Da.
    Residues 228 Isoelectric Point 5.98
    Sequence msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenvnlddypd dsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfevsqfliengasvrikdk fnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhalaeghgdaavllvekygaeydlvdnk gakaedvalneqvkkfflnnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.53 Rfree 0.25
    Matthews' coefficent 2.50 Rfactor 0.179
    Waters 182 Solvent Content 51.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wg0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch