.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wfu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of fibronectin type III domain of mouse hypothetical protein. To be Published
    Site RSGI
    PDB Id 1wfu Target Id mmt007105997.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13599, Molecular Weight 12476.60 Da.
    Residues 107 Isoelectric Point 6.59
    Sequence mephkvvplskphppvvgkvthhsielywdleqkekrqgpqeqwlrfsieeedpkmhsygviytgyatr hvvegleprtlykfrlkvtspsgeyeyspvvsvattre
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wfu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch