The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein. J.Struct.Funct.Genom. 11 181-188 2010
    Site RSGI
    PDB Id 1wfq Target Id hsk002000864.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12614, Molecular Weight 8466.15 Da.
    Residues 76 Isoelectric Point 7.99
    Sequence gypngtsaalretgvieklltsygfiqcserqarlffhcsqyngnlqdlkvgddvefevssdrrtgkpi avklvki
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wfq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch