The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the zf-AN1 domain from mouse RIKEN cDNA 2810002D23 protein. To be Published
    Site RSGI
    PDB Id 1wff Target Id mmt007011622.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13540, Molecular Weight 8140.01 Da.
    Residues 72 Isoelectric Point 9.30
    Sequence ihhlppvkaplqtkkkimkhcflcgkktglatsfecrcgnnfcashryaeahgcnydyksagrryleea npv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1wff

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch