The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the PDZ domain of Enigma homologue protein. To be published
    Site RSGI
    PDB Id 1wf7 Target Id mmt007006937.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13496, Molecular Weight 9306.14 Da.
    Residues 90 Isoelectric Point 9.43
    Sequence svslvgpapwgfrlqggkdfnmpltisslkdggkasqahvrigdvvlsidgisaqgmthleaqnkikac tgslnmtlqrasaaaksepvs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wf7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch