.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wf1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RRM domain in RNA-binding protein NP_057951. To be Published
    Site RSGI
    PDB Id 1wf1 Target Id hss001001895.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13283, Molecular Weight 10564.46 Da.
    Residues 97 Isoelectric Point 9.78
    Sequence mslklqasnvtnkndpksinsrvfignlntalvkksdvetifskygrvagcsvhkgyafvqysnerhar aavlgengrvlagqtldinmagepkpdr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wf1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch