The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PHD domain in protein NP_082203. To be Published
    Site RSGI
    PDB Id 1wev Target Id mmt007008926.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13509, Molecular Weight 8446.38 Da.
    Residues 75 Isoelectric Point 7.82
    Sequence addfamemglacvvcrqmtvasgnqlvecqechnlyhqdchkpqvtdkevnxpsrgvvlcpgtrqmkrm aqknqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 1wev

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch