.
The Open Protein Structure Annotation Network
PDB Keyword
.

1weu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of PHD domain in ING1-like protein BAC25009. To be Published
    Site RSGI
    PDB Id 1weu Target Id mmt007004614.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13476, Molecular Weight 8711.23 Da.
    Residues 78 Isoelectric Point 4.42
    Sequence speygmpsvtfgsvhpsdvldmpvdpneptyclchqvsygemigcdnpdcsiewfhfascgadnqprgk wxfprcsqe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1weu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch