.
The Open Protein Structure Annotation Network
PDB Keyword
.

1weo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RING-finger in the catalytic subunit (IRX3) of cellulose synthase. To be Published
    Site RSGI
    PDB Id 1weo Target Id atr001009297.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12249, Molecular Weight 9105.66 Da.
    Residues 80 Isoelectric Point 4.62
    Sequence pkplknldgqfceicgdqigltvegdlfvacnecgfpacrpcyeyerregtqncpqcktrykrlrgspr vegdedeedid
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1weo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch