The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of KH domain in protein BAB28342. To be Published
    Site RSGI
    PDB Id 1we8 Target Id mmk001004200.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13447, Molecular Weight 9974.93 Da.
    Residues 91 Isoelectric Point 9.07
    Sequence iltentpyfeqlsvpqrsvgriigrggetirsickasgakitcdkesegtlllsrlikisgtqkevaaa khlilekvsedeelrkriahsa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1we8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch