.
The Open Protein Structure Annotation Network
PDB Keyword
.

1we6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Ubiquitin-like domain in splicing factor AAL91182. To be Published
    Site RSGI
    PDB Id 1we6 Target Id atr001004705.1
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS12238, Molecular Weight 10692.54 Da.
    Residues 98 Isoelectric Point 5.65
    Sequence kfdesalvpedqflaqhpgpatirvskpnendgqfmeitvqslsenvgslkekiageiqipankqklsg kagflkdnmslahynvgageiltlslrer
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1we6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch