.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wdz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RCB domain of IRSp53. TO BE PUBLISHED
    Site RSGI
    PDB Id 1wdz Target Id srz001000130.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14032, Molecular Weight 26293.64 Da.
    Residues 229 Isoelectric Point 8.89
    Sequence mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmgelasesqgs kelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaalkkyqteqrskgdaldkcq aelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvsdgyktalteerrrfcflvekqcavakn saayhskgkellaqklplwqqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.63 Rfree 0.297
    Matthews' coefficent 2.34 Rfactor 0.235
    Waters 70 Solvent Content 47.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wdz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch