.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wdw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conformational Changes in the Tryptophan Synthase from a Hyperthermophile upon alpha(2)beta(2) Complex Formation: Crystal Structure of the Complex. Biochemistry 44 11417-11427 2005
    Site RSGI
    PDB Id 1wdw Target Id my_001000046.1
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13723, Molecular Weight 27495.34 Da.
    Residues 248 Isoelectric Point 8.78
    Sequence mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralkngfklreaf wivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvfhakefteiareegiktvf laapntpderlkviddmttgfvylvslygttgareeipktaydllrrakricrnkvavgfgvskrehvv sllkegangvvvgsalvkiigekgreateflkkkveellgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 3.00 Rfree 0.231
    Matthews' coefficent 2.90 Rfactor 0.196
    Waters 221 Solvent Content 58.00

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1wdw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch