.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wde

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of two archaeal diphthine synthases: insights into the post-translational modification of elongation factor 2. Acta Crystallogr.,Sect.D 64 397-406 2008
    Site RSGI
    PDB Id 1wde Target Id ape001000931.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12101, Molecular Weight 31449.09 Da.
    Residues 294 Isoelectric Point 5.31
    Sequence margreavtlllvgwgyapgmqtlealdavrradvvyvesytmpgsswlyksvveaagearvveasrrd leersreivsraldavvavvtagdpmvatthsslaaealeagvavryipgvsgvqaargatmlsfyrfg gtvtlpgpwrgvtpisvarriylnlcaglhttalldvdergvqlspgqgvsllleadreyareagapal larlpsvlveagaggghrvlywsslerlstadveggvysiviparlsgveewllaaasgqrrpleydrs vyetveenckkgvymepv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.244
    Matthews' coefficent 2.00 Rfactor 0.199
    Waters 116 Solvent Content 39.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wde

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch