The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title crystal structure of JW1657 from Escherichia coli. To be Published
    Site RSGI
    PDB Id 1wd6 Target Id eco001001948.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12270, Molecular Weight 11287.28 Da.
    Residues 101 Isoelectric Point 5.09
    Sequence matllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeksalaylekh tarlknlgveevvakvfdvneplsqinqakla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.242
    Matthews' coefficent 3.66 Rfactor 0.208
    Waters 18 Solvent Content 66.42

    Ligand Information


    Google Scholar output for 1wd6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch