.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wd5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a predicted phosphoribosyltransferase (TT1426) from Thermus thermophilus HB8 at 2.01 A resolution. Protein Sci. 14 823-827 2005
    Site RSGI
    PDB Id 1wd5 Target Id ttk003001426.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14721, Molecular Weight 22379.48 Da.
    Residues 208 Isoelectric Point 5.67
    Sequence mrfrdrrhagallaealaplgleapvvlglprggvvvadevarrlggeldvvlvrkvgapgnpefalga vgeggelvlmpyalryadqsylereaarqrdvlrkraeryrrvrpkaarkgrdvvlvddgvatgasmea alsvvfqegprrvvvavpvaspeaverlkaraevvalsvpqdfaavgayyldfgevtdedveaillewag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.227
    Matthews' coefficent 3.10 Rfactor 0.195
    Waters 224 Solvent Content 59.80

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1wd5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch