.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wcw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uroporphyrinogen III Synthase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1wcw Target Id ttk003001434.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14722, Molecular Weight 28398.55 Da.
    Residues 261 Isoelectric Point 9.46
    Sequence mrrleedavrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflattgv gvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllpqgrgvaalql ygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdalafvaaiqveflfegakdpka lrealntrvkalavgrvtadalrewgvkpfyvdeterlgsllqgfkralqkeva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.216
    Matthews' coefficent 2.31 Rfactor 0.188
    Waters 308 Solvent Content 46.66

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1wcw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch